DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and Hspb2

DIOPT Version :10

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_077761.3 Gene:Hspb2 / 69253 MGIID:1916503 Length:182 Species:Mus musculus


Alignment Length:104 Identity:36/104 - (34%)
Similarity:56/104 - (53%) Gaps:4/104 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GSAPDLSRVIVGKDGFEANVDVHLFKPYEISVKTSGDTVVVEAKHEKRRDGDTFVGRHIVKRFVL 107
            |:....|.:.:.:..|:|.:||..|.|.|::|:|..:.:.|.|:|.:|.|...||.|...:.:||
Mouse    59 GARAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVL 123

  Fly   108 PRGYYPNDVRSELSSDGILTVKCP---PYLTNE-RSVYV 142
            |....|..||:.||.||||.::.|   .:|..| ..||:
Mouse   124 PADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYI 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 29/76 (38%)
Hspb2NP_077761.3 Crystallin <21..51 CDD:425732
alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 67..148 CDD:469641 29/80 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.