DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and Hspb3

DIOPT Version :10

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_064344.1 Gene:Hspb3 / 56534 MGIID:1928479 Length:154 Species:Mus musculus


Alignment Length:76 Identity:25/76 - (32%)
Similarity:42/76 - (55%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GKDGFEANVDVHLFKPYEISVKTSGDTVVVEAKHEKRRDGDTFVGRHIVKRFVLPRGYYPNDVRS 118
            ||..|:..:||..|.|.:|.::|....::::|:|..|.|...|:.|...:::.||.|....|:.:
Mouse    71 GKSRFQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDEHGFISRSFTRQYKLPDGVETKDLSA 135

  Fly   119 ELSSDGILTVK 129
            .|..||||.|:
Mouse   136 ILCHDGILVVE 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 25/76 (33%)
Hspb3NP_064344.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..71 25/76 (33%)
ACD_HspB3_Like 67..149 CDD:107232 25/76 (33%)

Return to query results.
Submit another query.