DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and hspb15

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001092202.1 Gene:hspb15 / 555589 ZFINID:ZDB-GENE-080214-5 Length:154 Species:Danio rerio


Alignment Length:98 Identity:30/98 - (30%)
Similarity:50/98 - (51%) Gaps:4/98 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SLSRVGSAPDLSRVI----VGKDGFEANVDVHLFKPYEISVKTSGDTVVVEAKHEKRRDGDTFVG 98
            |.|..||...:|..:    :|:..::..:||..|.|.||||||....:.:...||:|::....:.
Zfish    15 SKSCTGSEGHVSDAVCEQMIGEQDWKVCLDVGPFSPEEISVKTRDGYLEITGNHEERQENHRLIS 79

  Fly    99 RHIVKRFVLPRGYYPNDVRSELSSDGILTVKCP 131
            |...:::.||.......:.|.||.||:|:|:.|
Zfish    80 RSFARKYKLPADLDLKQISSMLSPDGVLSVEAP 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 24/76 (32%)
hspb15NP_001092202.1 metazoan_ACD 35..113 CDD:107247 25/78 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.