DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and hspb7

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001006040.1 Gene:hspb7 / 450019 ZFINID:ZDB-GENE-041010-136 Length:161 Species:Danio rerio


Alignment Length:119 Identity:34/119 - (28%)
Similarity:55/119 - (46%) Gaps:12/119 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 YWDYRRRLWRDWDLNDWDLPYWKRSL---SRVGSAPDLSRVIVGKDGFEANVDVHLFKPYEISVK 75
            |.:..|.|:.| |...:..|  |.:|   :|.|:..::..:   .|.::..|||..|.|.::.|.
Zfish    32 YMEKSRGLFAD-DFGSFMCP--KDALGFPNRTGTVGNIKTL---GDTYQFTVDVQDFSPEDVIVT 90

  Fly    76 TSGDTVVVEAKHEKRRDGDTFVGRHIVKRFVLPRGYYPNDVRSELSSDGILTVK 129
            ||.:.:.|   |.::...|..|......:..||....|..|:|.|.:||.||:|
Zfish    91 TSNNQIEV---HAEKLASDGTVMNTFTHKCRLPEDVDPTSVKSSLGADGTLTIK 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 24/76 (32%)
hspb7NP_001006040.1 ACD_HspB7_like 64..144 CDD:107234 24/84 (29%)
IbpA <65..158 CDD:223149 24/83 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.