DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and hspb8

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001005658.1 Gene:hspb8 / 448147 XenbaseID:XB-GENE-945643 Length:202 Species:Xenopus tropicalis


Alignment Length:136 Identity:38/136 - (27%)
Similarity:55/136 - (40%) Gaps:25/136 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LWRDWDLNDWDLP----YWKRSL---------------SRVGSAPDLSRVIVG-KDGFEANVDVH 65
            |..||.  ||..|    .|...|               ||....||....:.. ...::..|:|.
 Frog    47 LTMDWP--DWARPRLTSAWSGPLRSGLVRSGMPPPVYNSRYTGYPDARNTVANISQPWKVCVNVQ 109

  Fly    66 LFKPYEISVKTSGDTVVVEAKHEKRRDGDTFVGRHIVKRFVLPRGYYPNDVRSELSSDGILTVKC 130
            .|||.|::|||....|.|...||:::.....|.::..|:|.||.......|.:.||.:|:|.::.
 Frog   110 TFKPEELTVKTKDGFVEVSGNHEEQQKEGGIVSKNFTKKFQLPPEVDAQTVFASLSPEGLLIIEA 174

  Fly   131 ---PPY 133
               |||
 Frog   175 PVVPPY 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 23/80 (29%)
hspb8NP_001005658.1 alpha-crystallin-Hsps_p23-like 86..175 CDD:381838 25/88 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.