DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and cryabb

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_021331756.1 Gene:cryabb / 436943 ZFINID:ZDB-GENE-040718-419 Length:180 Species:Danio rerio


Alignment Length:112 Identity:44/112 - (39%)
Similarity:64/112 - (57%) Gaps:10/112 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PYWKRSLSRVGSAPDLSRVIVGKDGFEANVDVHLFKPYEISVKTSGDTVVVEAKHEKRRDGDTFV 97
            |.|..|        .:|.|.:.||.|..::||..|.|.|:|||..||.:.:.||||.|:||..||
Zfish    47 PSWMES--------GVSEVKMEKDQFSLSLDVKHFAPEELSVKIIGDFIEIHAKHEDRQDGHGFV 103

  Fly    98 GRHIVKRFVLPRGYYPNDVRSELSSDGILTVKCPPYLTN--ERSVYV 142
            .|..::::.:|.|..|..:.|.|||||:|||..|..|::  ||::.:
Zfish   104 SREFLRKYRVPVGVDPASITSSLSSDGVLTVTGPLKLSDGPERTIAI 150

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 35/76 (46%)