DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and Hsp26

DIOPT Version :10

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_523997.1 Gene:Hsp26 / 39075 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster


Alignment Length:106 Identity:49/106 - (46%)
Similarity:72/106 - (67%) Gaps:5/106 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VGKDGFEANVDVHLFKPYEISVKTSGDTVVVEAKHEKRRDGDTFVGRHIVKRFVLPRGYYPNDVR 117
            ||||||:..:||..|||.|::||...|:::||.|||:|:|....:.||.|:|:.:|.||....|.
  Fly    84 VGKDGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYKAEQVV 148

  Fly   118 SELSSDGILTVKCP-PYL----TNERSVYVRQVGPSYLSIK 153
            |:|||||:|||..| |..    :.||.:.::||||::|::|
  Fly   149 SQLSSDGVLTVSIPKPQAVEDKSKERIIQIQQVGPAHLNVK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 38/76 (50%)
Hsp26NP_523997.1 metazoan_ACD 85..163 CDD:107247 38/77 (49%)

Return to query results.
Submit another query.