DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and l(2)efl

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster


Alignment Length:176 Identity:59/176 - (33%)
Similarity:82/176 - (46%) Gaps:31/176 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALVPATNNTDWDYWDYRRR------------LWRD------WDLNDWDL------PYWKRSLSR 41
            |::||......||..|:..|            |.||      |:.....|      |:...||.:
  Fly     1 MSVVPLMFRDWWDELDFPMRTSRLLDQHFGQGLKRDDLMSSVWNSRPTVLRSGYLRPWHTNSLQK 65

  Fly    42 VGSAPDLSRVIVGKDGFEANVDVHLFKPYEISVKTSGDTVVVEAKHEKRRDGDTFVGRHIVKRFV 106
            ..|...|:   :..:.||..:||..|.|.||:||.:...|:||.|||:::|...:|.|...:|:.
  Fly    66 QESGSTLN---IDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQ 127

  Fly   107 LPRGYYPNDVRSELSSDGILTVKCP----PYLTNERSVYVRQVGPS 148
            ||....|:.|.|.|||||:||:|.|    |....||.|.:.|.|||
  Fly   128 LPSDVNPDTVTSSLSSDGLLTIKAPMKALPPPQTERLVQITQTGPS 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 33/76 (43%)
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 34/84 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
Isobase 1 0.950 - 0 Normalized mean entropy S4216
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.