DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and CG14207

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster


Alignment Length:94 Identity:37/94 - (39%)
Similarity:53/94 - (56%) Gaps:6/94 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 DLSRVIVGKDG----FEANVDVHLFKPYEISVKTSGDTVVVEAKHEKRRDGDTFVGRHIVKRFVL 107
            |:|..::..:|    .:...||..:.|.||.|||....::|.||||::.|..: |.|...:.|:|
  Fly    89 DISSPLIQDEGDNKVLKLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKSDTKS-VYREYNREFLL 152

  Fly   108 PRGYYPNDVRSELSSDGILTVKCP-PYLT 135
            |:|..|..:||.||.||:|||..| |.||
  Fly   153 PKGVNPESIRSSLSKDGVLTVDAPLPALT 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 31/80 (39%)
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 31/81 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5129
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.