DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and Hspb7

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_038896.2 Gene:Hspb7 / 29818 MGIID:1352494 Length:169 Species:Mus musculus


Alignment Length:74 Identity:23/74 - (31%)
Similarity:33/74 - (44%) Gaps:3/74 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DGFEANVDVHLFKPYEISVKTSGDTVVVEAKHEKRRDGDTFVGRHIVKRFVLPRGYYPNDVRSEL 120
            |.:|..||:..|.|.:|.|.|..:.:.|.|   ::...|..|......:..||....|..|.|.|
Mouse    79 DAYEFTVDMRDFSPEDIIVTTFNNHIEVRA---EKLAADGTVMNTFAHKCQLPEDVDPTSVTSAL 140

  Fly   121 SSDGILTVK 129
            ..||.||::
Mouse   141 REDGSLTIR 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 23/74 (31%)
Hspb7NP_038896.2 Required for localization to SC35 splicing speckles. /evidence=ECO:0000250 1..70
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
ACD_HspB7_like 72..152 CDD:107234 23/74 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.