powered by:
Protein Alignment CG7409 and Hspb7
DIOPT Version :9
Sequence 1: | NP_648155.1 |
Gene: | CG7409 / 38870 |
FlyBaseID: | FBgn0035817 |
Length: | 154 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_038896.2 |
Gene: | Hspb7 / 29818 |
MGIID: | 1352494 |
Length: | 169 |
Species: | Mus musculus |
Alignment Length: | 74 |
Identity: | 23/74 - (31%) |
Similarity: | 33/74 - (44%) |
Gaps: | 3/74 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 DGFEANVDVHLFKPYEISVKTSGDTVVVEAKHEKRRDGDTFVGRHIVKRFVLPRGYYPNDVRSEL 120
|.:|..||:..|.|.:|.|.|..:.:.|.| ::...|..|......:..||....|..|.|.|
Mouse 79 DAYEFTVDMRDFSPEDIIVTTFNNHIEVRA---EKLAADGTVMNTFAHKCQLPEDVDPTSVTSAL 140
Fly 121 SSDGILTVK 129
..||.||::
Mouse 141 REDGSLTIR 149
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3591 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.