DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and Cryab

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_037067.1 Gene:Cryab / 25420 RGDID:2414 Length:175 Species:Rattus norvegicus


Alignment Length:103 Identity:41/103 - (39%)
Similarity:57/103 - (55%) Gaps:4/103 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PYWKR--SLSRVGSAPD--LSRVIVGKDGFEANVDVHLFKPYEISVKTSGDTVVVEAKHEKRRDG 93
            |::.|  |..|..|..|  ||.:.:.||.|..|:||..|.|.|:.||..||.:.|..|||:|:|.
  Rat    46 PFYLRPPSFLRAPSWIDTGLSEMRMEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDE 110

  Fly    94 DTFVGRHIVKRFVLPRGYYPNDVRSELSSDGILTVKCP 131
            ..|:.|...:::.:|....|..:.|.|||||:|||..|
  Rat   111 HGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGP 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 32/76 (42%)
CryabNP_037067.1 Crystallin 1..52 CDD:395419 2/5 (40%)
ACD_alphaB-crystallin_HspB5 67..150 CDD:107246 33/82 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 142..175 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.