DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and Hspb1

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_114176.4 Gene:Hspb1 / 24471 RGDID:61306 Length:206 Species:Rattus norvegicus


Alignment Length:99 Identity:35/99 - (35%)
Similarity:57/99 - (57%) Gaps:1/99 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PYWKRSLSRVGSAPDLSRVIVGKDGFEANVDVHLFKPYEISVKTSGDTVVVEAKHEKRRDGDTFV 97
            |.:.|:|:|..|: .:|.:....|.:..::||:.|.|.|::|||....|.:..|||:|:|...::
  Rat    75 PAFSRALNRQLSS-GVSEIRQTADRWRVSLDVNHFAPEELTVKTKEGVVEITGKHEERQDEHGYI 138

  Fly    98 GRHIVKRFVLPRGYYPNDVRSELSSDGILTVKCP 131
            .|...:::.||.|..|..|.|.||.:|.|||:.|
  Rat   139 SRCFTRKYTLPPGVDPTLVSSSLSPEGTLTVEAP 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 28/76 (37%)
Hspb1NP_114176.4 Interaction with TGFB1I1. /evidence=ECO:0000269|PubMed:11546764 74..206 35/99 (35%)
ACD_HspB1_like 88..173 CDD:107230 30/85 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.