DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and Hspb6

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001012401.1 Gene:Hspb6 / 243912 MGIID:2685325 Length:162 Species:Mus musculus


Alignment Length:100 Identity:38/100 - (38%)
Similarity:53/100 - (53%) Gaps:3/100 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PYWKRSLSRVGSAPDLSRVIVGKDGFEANVDVHLFKPYEISVKTSGDTVVVEAKHEKRRDGDTFV 97
            ||:.|:.|   .|...::|......|...:||..|.|.|||||...|.|.|.|:||:|.|...|:
Mouse    52 PYYLRAPS---VALPTAQVSTDSGYFSVLLDVKHFLPEEISVKVVDDHVEVHARHEERPDEHGFI 113

  Fly    98 GRHIVKRFVLPRGYYPNDVRSELSSDGILTVKCPP 132
            .|...:|:.||.|..|..|.|.||.:|:|:::..|
Mouse   114 AREFHRRYRLPPGVDPAAVTSALSPEGVLSIQATP 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 31/76 (41%)
Hspb6NP_001012401.1 Involved in stabilization of the HSPB1:HSBP6 heterodimer. /evidence=ECO:0000250|UniProtKB:O14558 1..72 6/22 (27%)
Crystallin 5..56 CDD:278926 2/3 (67%)
ACD_HspB4-5-6 66..148 CDD:107233 32/81 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.