DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and Cryaa

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001276666.1 Gene:Cryaa / 24273 RGDID:2413 Length:196 Species:Rattus norvegicus


Alignment Length:174 Identity:45/174 - (25%)
Similarity:75/174 - (43%) Gaps:42/174 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YRRRLWRDW---DLNDWDL---------PYWKRSLSRVGSAPDLSRVIV---------------- 53
            |..||:..:   .|.::||         ||:::||.|......:|.::.                
  Rat    18 YPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISELMTHMWFVMHQPHAGNPKN 82

  Fly    54 --GK-----DGFEANVDVHLFKPYEISVKTSGDTVVVEAKHEKRRDGDTFVGRHIVKRFVLPRGY 111
              ||     |.|...:||..|.|.:::||...|.|.:..||.:|:|...::.|...:|:.||...
  Rat    83 NPGKVRSDRDKFVIFLDVKHFSPEDLTVKVLEDFVEIHGKHNERQDDHGYISREFHRRYRLPSNV 147

  Fly   112 YPNDVRSELSSDGILTVKCPPYLT------NERSVYV-RQVGPS 148
            ..:.:...||:||:||...|...:      :||::.| |:..||
  Rat   148 DQSALSCSLSADGMLTFSGPKVQSGLDAGHSERAIPVSREEKPS 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 26/81 (32%)
CryaaNP_001276666.1 Crystallin 1..51 CDD:395419 8/32 (25%)
alpha-crystallin-Hsps_p23-like 86..168 CDD:412199 25/81 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.