DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and Hspb6

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_620242.1 Gene:Hspb6 / 192245 RGDID:621554 Length:162 Species:Rattus norvegicus


Alignment Length:100 Identity:39/100 - (39%)
Similarity:54/100 - (54%) Gaps:3/100 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PYWKRSLSRVGSAPDLSRVIVGKDGFEANVDVHLFKPYEISVKTSGDTVVVEAKHEKRRDGDTFV 97
            ||:.|:.|   .|...::|......|...:||..|.|.|||||..||.|.|.|:||:|.|...|:
  Rat    52 PYYLRAPS---VALPTAQVPTDPGYFSVLLDVKHFSPEEISVKVVGDHVEVHARHEERPDEHGFI 113

  Fly    98 GRHIVKRFVLPRGYYPNDVRSELSSDGILTVKCPP 132
            .|...:|:.||.|..|..|.|.||.:|:|:::..|
  Rat   114 AREFHRRYRLPPGVDPAAVTSALSPEGVLSIQATP 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 32/76 (42%)
Hspb6NP_620242.1 Involved in stabilization of the HSPB1:HSBP6 heterodimer. /evidence=ECO:0000250|UniProtKB:O14558 1..72 6/22 (27%)
Crystallin 3..58 CDD:395419 3/5 (60%)
ACD_HspB4-5-6 66..148 CDD:107233 33/81 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.