DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and hsp-12.1

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001076614.1 Gene:hsp-12.1 / 188710 WormBaseID:WBGene00011906 Length:112 Species:Caenorhabditis elegans


Alignment Length:133 Identity:33/133 - (24%)
Similarity:56/133 - (42%) Gaps:31/133 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALVPATNNT--DWDYWDYRRRLWRDWDLNDWDLPYWKRSLSRVGSAPDLSRVIVGKDGFEANVD 63
            |..:|.|.::  .|           ||.|...|               .:.:|....:.||..:|
 Worm     1 MHTIPITTDSAASW-----------DWPLQHND---------------GVVKVTNTSEKFEVGLD 39

  Fly    64 VHLFKPYEISVKTSGDTVVVEAKHEKRRDGDT---FVGRHIVKRFVLPRGYYPNDVRSELSSDGI 125
            ...|.|.:|.||.:|..:::..:|:..::..|   .|.|.:.:.:.||....|:.|||.|:|.|:
 Worm    40 AGFFGPNDIDVKVNGIEIIIHLRHDLLQNRPTEYGIVNREVHRTYKLPEDVDPSTVRSHLNSSGV 104

  Fly   126 LTV 128
            ||:
 Worm   105 LTI 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 24/78 (31%)
hsp-12.1NP_001076614.1 metazoan_ACD 26..111 CDD:107247 25/82 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4216
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.