powered by:
Protein Alignment CG7409 and F58H7.1
DIOPT Version :9
Sequence 1: | NP_648155.1 |
Gene: | CG7409 / 38870 |
FlyBaseID: | FBgn0035817 |
Length: | 154 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001343638.1 |
Gene: | F58H7.1 / 186550 |
WormBaseID: | WBGene00019067 |
Length: | 692 |
Species: | Caenorhabditis elegans |
Alignment Length: | 38 |
Identity: | 10/38 - (26%) |
Similarity: | 21/38 - (55%) |
Gaps: | 1/38 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 71 EISVKTSGDTVVVEAKHEKRRDGDTFVGRHIVKRFVLP 108
||.:|...|:|.:|...:::.|.:. :.:|.:|..:.|
Worm 352 EIKLKGDEDSVTIEITMDQKYDIEE-MEKHHIKAHITP 388
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG7409 | NP_648155.1 |
metazoan_ACD |
54..131 |
CDD:107247 |
10/38 (26%) |
F58H7.1 | NP_001343638.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3591 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.