DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and F58H7.1

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001343638.1 Gene:F58H7.1 / 186550 WormBaseID:WBGene00019067 Length:692 Species:Caenorhabditis elegans


Alignment Length:38 Identity:10/38 - (26%)
Similarity:21/38 - (55%) Gaps:1/38 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 EISVKTSGDTVVVEAKHEKRRDGDTFVGRHIVKRFVLP 108
            ||.:|...|:|.:|...:::.|.:. :.:|.:|..:.|
 Worm   352 EIKLKGDEDSVTIEITMDQKYDIEE-MEKHHIKAHITP 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 10/38 (26%)
F58H7.1NP_001343638.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.