DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and hsp-17

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001023957.1 Gene:hsp-17 / 186113 WormBaseID:WBGene00002021 Length:149 Species:Caenorhabditis elegans


Alignment Length:121 Identity:41/121 - (33%)
Similarity:67/121 - (55%) Gaps:8/121 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 YWDYRRRLWRDWDLNDWDL-PYWKRSL----SRVGSAPDLSRVIVGKDGFEANVDVHLFKPYEIS 73
            ::::.||.:.|.|.:...: |||....    .|||.|.|   |:.....:..:|||..|:|.|:.
 Worm    11 FFNHGRRFFDDVDFDRHMIRPYWADQTMLTGHRVGDAID---VVNNDQEYNVSVDVSQFEPEELK 72

  Fly    74 VKTSGDTVVVEAKHEKRRDGDTFVGRHIVKRFVLPRGYYPNDVRSELSSDGILTVK 129
            |....:.:::|.||.::.|....|.||.|:::.||.|..|..::||||::|:||||
 Worm    73 VNIVDNQLIIEGKHNEKTDKYGQVERHFVRKYNLPTGVRPEQIKSELSNNGVLTVK 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 28/76 (37%)
hsp-17NP_001023957.1 metazoan_ACD 49..128 CDD:107247 28/81 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3899
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.