DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and Hspb2

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_569115.1 Gene:Hspb2 / 161476 RGDID:70914 Length:182 Species:Rattus norvegicus


Alignment Length:118 Identity:42/118 - (35%)
Similarity:62/118 - (52%) Gaps:12/118 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YWKRSLSRVG-----SAPDLSRVIVGKDGFEANVDVHLFKPYEISVKTSGDTVVVEAKHEKRRDG 93
            |.:...:|.|     .|.:| |:..||  |:|.:||..|.|.|::|:|..:.:.|.|:|.:|.|.
  Rat    48 YVRPRAARAGEGGRAGASEL-RLSEGK--FQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDR 109

  Fly    94 DTFVGRHIVKRFVLPRGYYPNDVRSELSSDGILTVKCP---PYLTNE-RSVYV 142
            ..||.|...:.:|||....|..||:.||.||||.::.|   .:|..| ..||:
  Rat   110 HGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYI 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 31/76 (41%)
Hspb2NP_569115.1 Crystallin <16..51 CDD:395419 1/2 (50%)
alpha-crystallin-Hsps_p23-like 67..148 CDD:412199 33/83 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.