DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and CRYAB

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001276736.1 Gene:CRYAB / 1410 HGNCID:2389 Length:175 Species:Homo sapiens


Alignment Length:103 Identity:41/103 - (39%)
Similarity:57/103 - (55%) Gaps:4/103 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PYWKR--SLSRVGSAPD--LSRVIVGKDGFEANVDVHLFKPYEISVKTSGDTVVVEAKHEKRRDG 93
            |::.|  |..|..|..|  ||.:.:.||.|..|:||..|.|.|:.||..||.:.|..|||:|:|.
Human    46 PFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDE 110

  Fly    94 DTFVGRHIVKRFVLPRGYYPNDVRSELSSDGILTVKCP 131
            ..|:.|...:::.:|....|..:.|.|||||:|||..|
Human   111 HGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGP 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 32/76 (42%)
CRYABNP_001276736.1 Crystallin 1..52 CDD:395419 2/5 (40%)
ACD_alphaB-crystallin_HspB5 67..150 CDD:107246 33/82 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..175 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4216
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.