DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and CRYAA

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_000385.1 Gene:CRYAA / 1409 HGNCID:2388 Length:173 Species:Homo sapiens


Alignment Length:152 Identity:44/152 - (28%)
Similarity:73/152 - (48%) Gaps:21/152 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YRRRLWRDW---DLNDWDL---------PYWKRSLSRVGSAPDLSRVIVGKDGFEANVDVHLFKP 69
            |..||:..:   .|.::||         ||:::||.|......:|.|...:|.|...:||..|.|
Human    18 YPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSP 82

  Fly    70 YEISVKTSGDTVVVEAKHEKRRDGDTFVGRHIVKRFVLPRGYYPNDVRSELSSDGILTVKCPPYL 134
            .:::||...|.|.:..||.:|:|...::.|...:|:.||.....:.:...||:||:||. |.|.:
Human    83 EDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTF-CGPKI 146

  Fly   135 TN-------ERSVYV-RQVGPS 148
            ..       ||::.| |:..|:
Human   147 QTGLDATHAERAIPVSREEKPT 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 24/76 (32%)
CRYAANP_000385.1 Crystallin 1..51 CDD:395419 8/32 (25%)
ACD_alphaA-crystallin_HspB4 60..145 CDD:107245 27/85 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.