DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and Hspb8

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_446064.1 Gene:Hspb8 / 113906 RGDID:71003 Length:196 Species:Rattus norvegicus


Alignment Length:126 Identity:39/126 - (30%)
Similarity:58/126 - (46%) Gaps:22/126 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DWDLP----YWKRSLSRVGSAP----DLSRVIVGKDG----------FEANVDVHLFKPYEISVK 75
            :|.||    .|..:| |.|..|    ..:|..|..:|          ::..|:||.|||.|:.||
  Rat    50 EWALPRLSSAWPGTL-RSGMVPRGPTATARFGVPAEGRNPPPFPGEPWKVCVNVHSFKPEELMVK 113

  Fly    76 TSGDTVVVEAKHEKRRDGDTFVGRHIVKRFVLPRGYYPNDVRSELSSDGILTVKC---PPY 133
            |....|.|..|||:::.....|.::..|:..||....|..|.:.||.:|:|.::.   |||
  Rat   114 TKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPY 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 26/89 (29%)
Hspb8NP_446064.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
ACD_HspB8_like 80..170 CDD:107235 27/89 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..196
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.