DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and hspb2

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_002932983.1 Gene:hspb2 / 100497635 XenbaseID:XB-GENE-940436 Length:179 Species:Xenopus tropicalis


Alignment Length:93 Identity:32/93 - (34%)
Similarity:51/93 - (54%) Gaps:2/93 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVGSAPD--LSRVIVGKDGFEANVDVHLFKPYEISVKTSGDTVVVEAKHEKRRDGDTFVGRHIVK 103
            |:....|  .|.:...:..|:..:||..|.|.||||.|..:.:.|.|||.::.|...||.|...:
 Frog    52 RINKQTDRGFSEINRNEHKFQVFLDVCHFLPDEISVHTMDNLLEVSAKHPQKIDSHGFVSRSFNR 116

  Fly   104 RFVLPRGYYPNDVRSELSSDGILTVKCP 131
            :::||....|..|:::||.||||:::.|
 Frog   117 KYILPLDVDPLLVKAKLSHDGILSIEAP 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 28/76 (37%)
hspb2XP_002932983.1 Crystallin <21..51 CDD:278926
IbpA <63..149 CDD:223149 29/82 (35%)
alpha-crystallin-Hsps_p23-like 69..145 CDD:294116 29/76 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.