DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and cryab

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_002932964.1 Gene:cryab / 100494321 XenbaseID:XB-GENE-971379 Length:173 Species:Xenopus tropicalis


Alignment Length:122 Identity:41/122 - (33%)
Similarity:59/122 - (48%) Gaps:20/122 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LPYWKRSLSRVGSAPDLSRVIVGKDGFEANVDVHLFKPYEISVKTSGDTVVVEAKHEKRRDGDTF 96
            ||.|..|        .||.:.:.||.|..|:||..|.|.|::||..||.:.:...||:|:|...:
 Frog    55 LPNWIDS--------GLSEMKIDKDRFSVNLDVKHFSPEELNVKVLGDFIEIHGTHEERQDEHGY 111

  Fly    97 VGRHIVKRFVLPRGYYPNDVRSELSSDGILTV-----------KCPPYLTNERSVYV 142
            |.|...:|:.:|....|..:.|.||.||:|||           :|.| :|.|..|.:
 Frog   112 VSRDFQRRYKIPSDVDPQSITSTLSPDGVLTVSGPRKVSEVPERCIP-ITREEKVAI 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 30/87 (34%)
cryabXP_002932964.1 Crystallin 1..51 CDD:366148
alpha-crystallin-Hsps_p23-like 65..148 CDD:381838 30/82 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.