DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and cryaa

DIOPT Version :10

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_031752202.1 Gene:cryaa / 100488185 XenbaseID:XB-GENE-5940571 Length:115 Species:Xenopus tropicalis


Alignment Length:91 Identity:32/91 - (35%)
Similarity:47/91 - (51%) Gaps:0/91 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PDLSRVIVGKDGFEANVDVHLFKPYEISVKTSGDTVVVEAKHEKRRDGDTFVGRHIVKRFVLPRG 110
            |.:.:|...:|.|..|:||..|.|.::|||...|.|.:..||.:|:|...::.|...:|:.||..
 Frog     3 PFVPQVRSDRDRFFINLDVKHFSPEDLSVKLHDDFVEIHGKHNERQDDHGYISREFHRRYRLPSN 67

  Fly   111 YYPNDVRSELSSDGILTVKCPPYLTN 136
            ...|.|...||:||||:...|....|
 Frog    68 VDQNSVSCTLSADGILSFSGPKLQPN 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 28/76 (37%)
cryaaXP_031752202.1 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 5..89 CDD:469641 29/83 (35%)

Return to query results.
Submit another query.