DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and si:dkey-1k23.3

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_002662020.3 Gene:si:dkey-1k23.3 / 100331249 ZFINID:ZDB-GENE-160113-121 Length:365 Species:Danio rerio


Alignment Length:129 Identity:42/129 - (32%)
Similarity:66/129 - (51%) Gaps:12/129 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 W--DYRRRL----WRDWDLNDWDLPYWKRSLSRVGSAP------DLSRVIVGKDGFEANVDVHLF 67
            |  |..|||    |..:..:.:..|..:.|...|.|.|      .:|.|......::.::||:.|
Zfish    44 WMEDIFRRLGTSSWPGYVRSGFLAPLLQASGPAVFSKPHRELSGGVSEVAAETCRWKISLDVNHF 108

  Fly    68 KPYEISVKTSGDTVVVEAKHEKRRDGDTFVGRHIVKRFVLPRGYYPNDVRSELSSDGILTVKCP 131
            .|.|||||.....:.:..|||:|:||..|:.|...:::.||.|....::::.||:||||||:.|
Zfish   109 APAEISVKIQHGFLEIAGKHEERQDGHGFIARSFTRKYNLPGGIEVENLQTSLSADGILTVEAP 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 28/76 (37%)
si:dkey-1k23.3XP_002662020.3 alpha-crystallin-Hsps_p23-like 88..172 CDD:320797 30/83 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.