DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and hspb3

DIOPT Version :10

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_002941074.1 Gene:hspb3 / 100135387 XenbaseID:XB-GENE-969539 Length:145 Species:Xenopus tropicalis


Alignment Length:74 Identity:21/74 - (28%)
Similarity:38/74 - (51%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DGFEANVDVHLFKPYEISVKTSGDTVVVEAKHEKRRDGDTFVGRHIVKRFVLPRGYYPNDVRSEL 120
            |.|:..:||..|:|.:|.::.....::::.:|..|.|...|:.|...:.:.||.|....|:.:..
 Frog    61 DKFKVLLDVVQFRPEDIIIQVFEGWLIIKGEHGCRMDEHGFISRSFTRTYQLPNGIGLTDLSAFF 125

  Fly   121 SSDGILTVK 129
            ..||||.|:
 Frog   126 CHDGILAVE 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 21/74 (28%)
hspb3XP_002941074.1 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 55..137 CDD:469641 21/74 (28%)

Return to query results.
Submit another query.