DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and cryaa

DIOPT Version :10

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_694482.1 Gene:cryaa / 100000769 ZFINID:ZDB-GENE-020508-1 Length:173 Species:Danio rerio


Alignment Length:131 Identity:42/131 - (32%)
Similarity:66/131 - (50%) Gaps:16/131 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YRRRLWRDW---DLNDWDL---------PYWKRSLSR---VGSAPDLSRVIVGKDGFEANVDVHL 66
            |..||:..:   .|.|:||         ||::.||.|   ..|...:|.|...::.|...:||..
Zfish    16 YPTRLFDQFFGEGLFDYDLFPFTTSTVSPYYRHSLFRNILDSSNSGVSEVRSDREKFTVYLDVKH 80

  Fly    67 FKPYEISVKTSGDTVVVEAKHEKRRDGDTFVGRHIVKRFVLPRGYYPNDVRSELSSDGILTVKCP 131
            |.|.|:|||.:.|.|.::.||.:|:|...::.|...:|:.||.....:.:...||:||:||: |.
Zfish    81 FSPDELSVKVTDDYVEIQGKHGERQDDHGYISREFHRRYRLPSNVDQSAITCTLSADGLLTL-CG 144

  Fly   132 P 132
            |
Zfish   145 P 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 25/76 (33%)
cryaaNP_694482.1 Crystallin 1..52 CDD:425732 11/35 (31%)
alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 61..146 CDD:469641 29/86 (34%)

Return to query results.
Submit another query.