DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7409 and cryaa

DIOPT Version :9

Sequence 1:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_694482.1 Gene:cryaa / 100000769 ZFINID:ZDB-GENE-020508-1 Length:173 Species:Danio rerio


Alignment Length:131 Identity:42/131 - (32%)
Similarity:66/131 - (50%) Gaps:16/131 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YRRRLWRDW---DLNDWDL---------PYWKRSLSR---VGSAPDLSRVIVGKDGFEANVDVHL 66
            |..||:..:   .|.|:||         ||::.||.|   ..|...:|.|...::.|...:||..
Zfish    16 YPTRLFDQFFGEGLFDYDLFPFTTSTVSPYYRHSLFRNILDSSNSGVSEVRSDREKFTVYLDVKH 80

  Fly    67 FKPYEISVKTSGDTVVVEAKHEKRRDGDTFVGRHIVKRFVLPRGYYPNDVRSELSSDGILTVKCP 131
            |.|.|:|||.:.|.|.::.||.:|:|...::.|...:|:.||.....:.:...||:||:||: |.
Zfish    81 FSPDELSVKVTDDYVEIQGKHGERQDDHGYISREFHRRYRLPSNVDQSAITCTLSADGLLTL-CG 144

  Fly   132 P 132
            |
Zfish   145 P 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 25/76 (33%)
cryaaNP_694482.1 Crystallin 1..48 CDD:278926 9/31 (29%)
alpha-crystallin-Hsps_p23-like 61..146 CDD:294116 29/86 (34%)
IbpA <64..146 CDD:223149 28/83 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.