DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8492 and 9530003J23Rik

DIOPT Version :9

Sequence 1:NP_648151.2 Gene:CG8492 / 38866 FlyBaseID:FBgn0035813 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_084182.2 Gene:9530003J23Rik / 77397 MGIID:1924647 Length:151 Species:Mus musculus


Alignment Length:128 Identity:50/128 - (39%)
Similarity:66/128 - (51%) Gaps:15/128 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 GKVYNRCELAQELYFSHKFPMQ--DLATWVCIAEHESSFNTTAVGRLN-ADGSADHGLFQISDLY 499
            ||||:||.||:.|........|  .||.|||:|:.||:|||... |.| .|.|..:|:|||:..:
Mouse    21 GKVYDRCSLARTLQSLGLAGFQGITLANWVCLAKWESNFNTNTT-RFNPEDQSTSYGIFQINSRF 84

  Fly   500 WCTHNDGGGKG----CHIDCNRLLDSDITDDVKCVRTIHEEHTRISGDGFTAWTVYNGHCRQK 558
            ||  |||...|    |.|.|..||.|:|...|.|.:.|.::     ..|..:|..:..||:.|
Mouse    85 WC--NDGKTPGSRNFCRISCKALLKSNIWSAVVCAKRIVKD-----PQGIYSWAGWIKHCKNK 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8492NP_648151.2 LYZ1 18..142 CDD:238066
LYZ1 185..312 CDD:238066
LYZ1 439..566 CDD:238066 49/127 (39%)
LYZ1 596..723 CDD:238066
PARM 937..>1068 CDD:293666
9530003J23RikNP_084182.2 LYZ1 22..147 CDD:238066 49/127 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.