DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8492 and SPACA5B

DIOPT Version :9

Sequence 1:NP_648151.2 Gene:CG8492 / 38866 FlyBaseID:FBgn0035813 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_001073369.1 Gene:SPACA5B / 729201 HGNCID:19142 Length:159 Species:Homo sapiens


Alignment Length:136 Identity:51/136 - (37%)
Similarity:77/136 - (56%) Gaps:10/136 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   592 TPKAKIYNRCELAKELYHR--HKFPMREIPTWVCIAEHESSFNTAAVGKLNADGSEDHGLFQISD 654
            |..||||.|||||..|...  :.:....:..|:|:|.:||.|:||.|.. |.|||.::|:||::.
Human    18 TVDAKIYERCELAARLERAGLNGYKGYGVGDWLCMAHYESGFDTAFVDH-NPDGSSEYGIFQLNS 81

  Fly   655 IYWCTHDQTSGK-ACHIECDRLLDSDISDDVQCIRTIHEEHTRLSGDGFNAWTVYNGHCRNQNLA 718
            .:||.:..|..| .||::|..||:..|.||::|.:.|..     |.:|.:|||.:..||...:|:
Human    82 AWWCDNGITPTKNLCHMDCHDLLNRHILDDIRCAKQIVS-----SQNGLSAWTSWRLHCSGHDLS 141

  Fly   719 K-LSDC 723
            : |..|
Human   142 EWLKGC 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8492NP_648151.2 LYZ1 18..142 CDD:238066
LYZ1 185..312 CDD:238066
LYZ1 439..566 CDD:238066
LYZ1 596..723 CDD:238066 48/130 (37%)
PARM 937..>1068 CDD:293666
SPACA5BNP_001073369.1 LYZ_C 22..147 CDD:340383 48/130 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153986
Domainoid 1 1.000 88 1.000 Domainoid score I7920
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41688
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.