DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8492 and Lyzl4

DIOPT Version :9

Sequence 1:NP_648151.2 Gene:CG8492 / 38866 FlyBaseID:FBgn0035813 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_001344275.2 Gene:Lyzl4 / 69032 MGIID:1916282 Length:145 Species:Mus musculus


Alignment Length:135 Identity:50/135 - (37%)
Similarity:69/135 - (51%) Gaps:20/135 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   595 AKIYNRCELAKELYH--RHKFPMREIPTWVCIAEHESSFNTAAVGKLNADGSEDHGLFQISDIYW 657
            |.|..||.:||.||.  .:.|....:..|||:|..||.||.:||.:...|||...|||||.|..|
Mouse    19 ASILGRCTVAKMLYDGGLNYFEGYSLENWVCLAYFESKFNPSAVYEDPQDGSTGFGLFQIRDNEW 83

  Fly   658 CTHDQTSGK-ACHIECDRLLDSDISDDVQCIRTIHE-EHTRLSGDGFNAWTVYNGHCRNQNLAKL 720
            |.|    || .|.:.|..||:.::.|.:||.:.|.: :|      |..||.:::.:|      :|
Mouse    84 CGH----GKNLCSVSCTALLNPNLKDTIQCAKKIVKGKH------GMGAWPIWSKNC------QL 132

  Fly   721 SDCFD 725
            ||..|
Mouse   133 SDVLD 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8492NP_648151.2 LYZ1 18..142 CDD:238066
LYZ1 185..312 CDD:238066
LYZ1 439..566 CDD:238066
LYZ1 596..723 CDD:238066 47/130 (36%)
PARM 937..>1068 CDD:293666
Lyzl4NP_001344275.2 LYZ_C 21..143 CDD:340383 49/133 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844146
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.