DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8492 and spaca5

DIOPT Version :9

Sequence 1:NP_648151.2 Gene:CG8492 / 38866 FlyBaseID:FBgn0035813 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_001011312.1 Gene:spaca5 / 496769 XenbaseID:XB-GENE-923467 Length:140 Species:Xenopus tropicalis


Alignment Length:128 Identity:36/128 - (28%)
Similarity:71/128 - (55%) Gaps:14/128 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   599 NRCELAKELYHRHKFPMR--EIPTWVCIAEHESSFNTAAVGKLNADGSEDHGLFQISDIYWCTHD 661
            :||.:.:.:.:.....::  .:..:||:|...|.::|:    ||...:| :|:|||:..:||...
 Frog    21 DRCSVVRAIRNGGVIGIKGYTLGDYVCLAYQASRYDTS----LNRSPTE-YGIFQINSYWWCNDG 80

  Fly   662 QTSGK--ACHIECDRLLDSDISDDVQCIRTIHEEHTRLSGDGFNAWTVYNGHCRNQNLAKLSD 722
            :|.|:  .|.:.|..||:|.|.|||:|::.|..:     .:|..||:|:..:|:.::|:..:|
 Frog    81 RTVGRKNLCGMSCTNLLNSYIDDDVRCLKRIVRD-----PNGLGAWSVWTRYCKGRDLSSYTD 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8492NP_648151.2 LYZ1 18..142 CDD:238066
LYZ1 185..312 CDD:238066
LYZ1 439..566 CDD:238066
LYZ1 596..723 CDD:238066 36/128 (28%)
PARM 937..>1068 CDD:293666
spaca5NP_001011312.1 LYZ_C 20..140 CDD:340383 36/128 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.