DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8492 and LysE

DIOPT Version :9

Sequence 1:NP_648151.2 Gene:CG8492 / 38866 FlyBaseID:FBgn0035813 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_476827.2 Gene:LysE / 38128 FlyBaseID:FBgn0004428 Length:140 Species:Drosophila melanogaster


Alignment Length:120 Identity:48/120 - (40%)
Similarity:70/120 - (58%) Gaps:10/120 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 GKVYNRCELAQELYFSHKFPMQDLATWVCIAEHESSFNTTAVGRLNADGSADHGLFQISDLYWCT 502
            |:..:||.||:|: .:...|...||.|.||||||||:.|..||..|.:||.|:|:|||::.|||.
  Fly    18 GRTLDRCSLAREM-SNLGVPRDQLARWACIAEHESSYRTGVVGPENYNGSNDYGIFQINNYYWCA 81

  Fly   503 HNDG--GGKGCHIDCNRLLDSDITDDVKCVRTIHEEHTRISGDGFTAWTVYNGHC 555
            ...|  ....|.:.||.||..|||..|:|.:.:      :|..|::||:.:: :|
  Fly    82 PPSGRFSYNECGLSCNALLTDDITHSVRCAQKV------LSQQGWSAWSTWH-YC 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8492NP_648151.2 LYZ1 18..142 CDD:238066
LYZ1 185..312 CDD:238066
LYZ1 439..566 CDD:238066 47/119 (39%)
LYZ1 596..723 CDD:238066
PARM 937..>1068 CDD:293666
LysENP_476827.2 Lys 19..139 CDD:278491 47/119 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458883
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9324
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.