DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8492 and CG16799

DIOPT Version :9

Sequence 1:NP_648151.2 Gene:CG8492 / 38866 FlyBaseID:FBgn0035813 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_001286641.1 Gene:CG16799 / 37340 FlyBaseID:FBgn0034538 Length:179 Species:Drosophila melanogaster


Alignment Length:128 Identity:47/128 - (36%)
Similarity:72/128 - (56%) Gaps:9/128 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   594 KAKIYNRCELAKELYHRHKFPMREIPTWVCIAEHESSFNTAAVGKLNADGSEDHGLFQISDIYWC 658
            ::|.|.||||.:.|...:.|....|..|:|:.||||..:|..|.| ..:.|:::|||||:...:|
  Fly    39 ESKKYQRCELTRVLVENYNFDKTFISNWICLVEHESYLDTTKVTK-KGNESKNYGLFQINSKDYC 102

  Fly   659 THDQTSGKACHIECDRLLDSDISDDVQCIRTIHEEHTRLSGDGFNAWTVYNGHCRN-QNLAKL 720
            :..:..|: |:::|:...:.|||||:.|.|.|.|.      :||..|..::..||| |||..|
  Fly   103 SEGRKGGQ-CNMKCEDFSNDDISDDIACARMIQER------EGFKYWKGWDRFCRNPQNLPNL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8492NP_648151.2 LYZ1 18..142 CDD:238066
LYZ1 185..312 CDD:238066
LYZ1 439..566 CDD:238066
LYZ1 596..723 CDD:238066 47/126 (37%)
PARM 937..>1068 CDD:293666
CG16799NP_001286641.1 LYZ1 41..162 CDD:238066 47/126 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458915
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26024
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.