DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8492 and RGD1306474

DIOPT Version :9

Sequence 1:NP_648151.2 Gene:CG8492 / 38866 FlyBaseID:FBgn0035813 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_001102216.1 Gene:RGD1306474 / 362881 RGDID:1306474 Length:151 Species:Rattus norvegicus


Alignment Length:130 Identity:45/130 - (34%)
Similarity:66/130 - (50%) Gaps:19/130 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 GKVYNRCELAQELYFSHKFPMQ-----DLATWVCIAEHESSFNTTAVGRLNADGSADHGLFQISD 497
            |||.|||.||:.|   .:|.:.     .||.|:|:|:..|.::|.|:...:.|.|.::|:||||.
  Rat    21 GKVLNRCLLARTL---QRFGLGGFKGISLANWICLAKSVSGYDTKAIKYNHEDRSTNYGIFQISS 82

  Fly   498 LYWCTHNDG---GGKG-CHIDCNRLLDSDITDDVKCVRTIHEEHTRISGDGFTAWTVYNGHCRQK 558
            .|||  ||.   |.|. |.:.|..||.::|...|.|.:.|.::..     |.|.|..:..:|..|
  Rat    83 RYWC--NDSKTPGSKNFCRVSCKALLKNNIKASVTCAKRIVKDPR-----GITTWEAWRKNCEHK 140

  Fly   559  558
              Rat   141  140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8492NP_648151.2 LYZ1 18..142 CDD:238066
LYZ1 185..312 CDD:238066
LYZ1 439..566 CDD:238066 44/129 (34%)
LYZ1 596..723 CDD:238066
PARM 937..>1068 CDD:293666
RGD1306474NP_001102216.1 LYZ1 22..149 CDD:197612 44/129 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45811
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.