DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8492 and Spaca5

DIOPT Version :9

Sequence 1:NP_648151.2 Gene:CG8492 / 38866 FlyBaseID:FBgn0035813 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_001101528.1 Gene:Spaca5 / 314431 RGDID:1584964 Length:160 Species:Rattus norvegicus


Alignment Length:136 Identity:47/136 - (34%)
Similarity:76/136 - (55%) Gaps:10/136 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   592 TPKAKIYNRCELAKELYHR--HKFPMREIPTWVCIAEHESSFNTAAVGKLNADGSEDHGLFQISD 654
            |..||||.|||||::|...  :.|....:..|:|:|.:||.|:|:.|.. |.|||.::|:||::.
  Rat    18 TVDAKIYERCELARKLEKAGLNGFKGYTVGDWLCVAHYESGFDTSFVDH-NPDGSSEYGIFQLNS 81

  Fly   655 IYWCTHDQT-SGKACHIECDRLLDSDISDDVQCIRTIHEEHTRLSGDGFNAWTVYNGHCRNQNLA 718
            .:||.:..| :...||::|:.||:..|.||:.|.:.:...|..:     .||..:..||...:|:
  Rat    82 AWWCNNGITPTQNLCHMDCNDLLNRHILDDIMCAKRVVSSHKSM-----KAWDSWTRHCAGHDLS 141

  Fly   719 K-LSDC 723
            : |..|
  Rat   142 EWLKGC 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8492NP_648151.2 LYZ1 18..142 CDD:238066
LYZ1 185..312 CDD:238066
LYZ1 439..566 CDD:238066
LYZ1 596..723 CDD:238066 44/130 (34%)
PARM 937..>1068 CDD:293666
Spaca5NP_001101528.1 LYZ_C 22..147 CDD:340383 44/130 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347583
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45811
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.