DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8492 and Lyzl6

DIOPT Version :9

Sequence 1:NP_648151.2 Gene:CG8492 / 38866 FlyBaseID:FBgn0035813 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_001129305.2 Gene:Lyzl6 / 287751 RGDID:1306968 Length:149 Species:Rattus norvegicus


Alignment Length:132 Identity:47/132 - (35%)
Similarity:71/132 - (53%) Gaps:12/132 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   597 IYNRCELAKELYHR--HKFPMREIPTWVCIAEHESSFNTAAVGKLNADGSEDHGLFQISDIYWCT 659
            |.|||.||:.||..  ..|....:|.|:|:|..||.||.:.|.: ||||:.|:|:|||:..|||.
  Rat    22 IINRCTLARILYQEDLDGFEGYSLPHWLCLAFVESKFNISKVTE-NADGTFDYGIFQINSRYWCN 85

  Fly   660 HDQT-SGKACHIECDRLLDSDISDDVQCIRTIHEEHTRLSGD-GFNAWTVYNGHCRNQNLAK-LS 721
            ..|: |...|.::|:.||:.::...:.|.:.|      :||. |...|..:..||..:.|:. |:
  Rat    86 DYQSHSENFCRLDCEELLNPNLIPSIHCAKMI------VSGSGGMKNWVDWRLHCLGRPLSYWLT 144

  Fly   722 DC 723
            .|
  Rat   145 GC 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8492NP_648151.2 LYZ1 18..142 CDD:238066
LYZ1 185..312 CDD:238066
LYZ1 439..566 CDD:238066
LYZ1 596..723 CDD:238066 46/130 (35%)
PARM 937..>1068 CDD:293666
Lyzl6NP_001129305.2 LYZ1 22..143 CDD:238066 45/127 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347522
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45811
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.