DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8492 and Spaca3

DIOPT Version :9

Sequence 1:NP_648151.2 Gene:CG8492 / 38866 FlyBaseID:FBgn0035813 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_001099290.1 Gene:Spaca3 / 287557 RGDID:1306684 Length:163 Species:Rattus norvegicus


Alignment Length:139 Identity:53/139 - (38%)
Similarity:74/139 - (53%) Gaps:18/139 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   594 KAKIYNRCELAKELYHRHKFPMR-----EIPTWVCIAEHESSFNTAAVGKLNADGSEDHGLFQIS 653
            |||:::||||||.|   |.|.:.     .:..|:|:|.:.|.|||.||.. .||||.::|:||||
  Rat    34 KAKVFSRCELAKVL---HDFGLEGYRGYNLADWICLAYYTSGFNTDAVDH-EADGSTNNGIFQIS 94

  Fly   654 DIYWCTHDQTSG-KACHIECDRLLDSDISDDVQCIRTIHEEHTRLSGDGFNAWTVYNGHCRNQNL 717
            ...||.:...:| ..|.|.|..||.:|:.|.|.|:..|.:|     ..|...|..:..||:.:: 
  Rat    95 SRKWCKNLAPNGPNLCRIYCTDLLSNDLKDSVACVMKIAQE-----PQGLGYWESWKHHCQGRD- 153

  Fly   718 AKLSDCFDG 726
              |||..||
  Rat   154 --LSDWVDG 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8492NP_648151.2 LYZ1 18..142 CDD:238066
LYZ1 185..312 CDD:238066
LYZ1 439..566 CDD:238066
LYZ1 596..723 CDD:238066 48/132 (36%)
PARM 937..>1068 CDD:293666
Spaca3NP_001099290.1 LYZ_C 36..161 CDD:340383 51/137 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45811
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.