DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8492 and Spaca5

DIOPT Version :9

Sequence 1:NP_648151.2 Gene:CG8492 / 38866 FlyBaseID:FBgn0035813 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_001078862.1 Gene:Spaca5 / 278203 MGIID:2685564 Length:160 Species:Mus musculus


Alignment Length:133 Identity:47/133 - (35%)
Similarity:74/133 - (55%) Gaps:10/133 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   595 AKIYNRCELAKELYHR--HKFPMREIPTWVCIAEHESSFNTAAVGKLNADGSEDHGLFQISDIYW 657
            ||||.||||||:|...  ..|....:..|:|:|.:||.|:|:.|.. |.|||.::|:||::..:|
Mouse    21 AKIYERCELAKKLEEAGLDGFKGYTVGDWLCVAHYESGFDTSFVDH-NPDGSSEYGIFQLNSAWW 84

  Fly   658 CTHDQT-SGKACHIECDRLLDSDISDDVQCIRTIHEEHTRLSGDGFNAWTVYNGHCRNQNLAK-L 720
            |.:..| :...|:|:|:.||:..|.||:.|.:.:...|..:     .||..:..||...:|:: |
Mouse    85 CNNGITPTQNLCNIDCNDLLNRHILDDIICAKRVASSHKSM-----KAWDSWTQHCAGHDLSEWL 144

  Fly   721 SDC 723
            ..|
Mouse   145 KGC 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8492NP_648151.2 LYZ1 18..142 CDD:238066
LYZ1 185..312 CDD:238066
LYZ1 439..566 CDD:238066
LYZ1 596..723 CDD:238066 45/130 (35%)
PARM 937..>1068 CDD:293666
Spaca5NP_001078862.1 LYZ1 22..145 CDD:238066 44/128 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844219
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.