DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8492 and Lyz2

DIOPT Version :9

Sequence 1:NP_648151.2 Gene:CG8492 / 38866 FlyBaseID:FBgn0035813 Length:1360 Species:Drosophila melanogaster
Sequence 2:XP_038934368.1 Gene:Lyz2 / 25211 RGDID:3026 Length:192 Species:Rattus norvegicus


Alignment Length:182 Identity:48/182 - (26%)
Similarity:72/182 - (39%) Gaps:63/182 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   590 SPTPKAKIYNRCELAKEL-------YHRHKFPMREIPTWVCIAEHESSFNTAAVGKLNADGSEDH 647
            |.:.:||.|.|||.|:.|       |:.     ..:..|||:|:|||::||.|......|.|.|:
  Rat    13 SASVQAKTYERCEFARTLKRNGMSGYYG-----VSLADWVCLAQHESNYNTQARNYNPGDQSTDY 72

  Fly   648 GLFQISDIYWCTHDQT--SGKACHIECD------------------------------------- 673
            |:|||:..|||...:|  :..||.|.|.                                     
  Rat    73 GIFQINSRYWCNDGKTPRAKNACGIPCSAVVTEKSSKHQQRRDILSLGTASIHLSGSLWETLLRN 137

  Fly   674 -------RLLDSDISDDVQCIRTIHEEHTRLSGDGFNAWTVYNGHCRNQNLA 718
                   .||..||:..:||.:.:..:     ..|..||..:..||:|::|:
  Rat   138 VNPAVHTSLLQDDITQAIQCAKRVVRD-----PQGIRAWVAWQRHCKNRDLS 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8492NP_648151.2 LYZ1 18..142 CDD:238066
LYZ1 185..312 CDD:238066
LYZ1 439..566 CDD:238066
LYZ1 596..723 CDD:238066 46/176 (26%)
PARM 937..>1068 CDD:293666
Lyz2XP_038934368.1 LYZ1 19..191 CDD:197612 46/176 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45811
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.