DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8492 and Lalba

DIOPT Version :9

Sequence 1:NP_648151.2 Gene:CG8492 / 38866 FlyBaseID:FBgn0035813 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_036726.1 Gene:Lalba / 24528 RGDID:2987 Length:159 Species:Rattus norvegicus


Alignment Length:156 Identity:46/156 - (29%)
Similarity:77/156 - (49%) Gaps:18/156 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVCLLLPLLATAKIFDRCELANLLQHRFGLPAAQVATLVCIAQHSSDFNTAAFGGGVGLGGGS-- 68
            :.|:.||.....: |.:||:::.::...|.....:....|:..|:|.:::.|    :....||  
  Rat     9 LACISLPAFQATE-FTKCEVSHAIEDMDGYQGISLLEWTCVLFHTSGYDSQA----IVKNNGSTE 68

  Fly    69 HGLFQISDVYWCSP---PGQGKGCGLSCSRLRDDDIADDVLCVRKIYAEHQRISGDGFTAWQAYD 130
            :||||||:..||..   |.....|.:||.:..||::|||::|.:||.|    |.|..:  |:|:.
  Rat    69 YGLFQISNRNWCKSSEFPESENICDISCDKFLDDELADDIVCAKKIVA----IKGIDY--WKAHK 127

  Fly   131 AYCRQDANSYVAGCGGPGSSALSVAA 156
            ..|.:....:  .|..||:.||.|.|
  Rat   128 PMCSEKLEQW--RCEKPGAPALVVPA 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8492NP_648151.2 LYZ1 18..142 CDD:238066 36/128 (28%)
LYZ1 185..312 CDD:238066
LYZ1 439..566 CDD:238066
LYZ1 596..723 CDD:238066
PARM 937..>1068 CDD:293666
LalbaNP_036726.1 Lys 20..137 CDD:395016 36/127 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347582
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.710

Return to query results.
Submit another query.