DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8492 and Lyz2

DIOPT Version :9

Sequence 1:NP_648151.2 Gene:CG8492 / 38866 FlyBaseID:FBgn0035813 Length:1360 Species:Drosophila melanogaster
Sequence 2:NP_059068.1 Gene:Lyz2 / 17105 MGIID:96897 Length:148 Species:Mus musculus


Alignment Length:144 Identity:50/144 - (34%)
Similarity:77/144 - (53%) Gaps:20/144 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   590 SPTPKAKIYNRCELAKEL-------YHRHKFPMREIPTWVCIAEHESSFNTAAVGKLNADGSEDH 647
            |.|.:||:|.|||.|:.|       |:.     ..:..|||:|:|||::||.|......|.|.|:
Mouse    13 SVTAQAKVYERCEFARTLKRNGMAGYYG-----VSLADWVCLAQHESNYNTRATNYNRGDQSTDY 72

  Fly   648 GLFQISDIYWCTHDQT--SGKACHIECDRLLDSDISDDVQCIRTIHEEHTRLSGDGFNAWTVYNG 710
            |:|||:..|||...:|  :..||.|.|..||..||:..:||.:.:..:     ..|..||..:..
Mouse    73 GIFQINSRYWCNDGKTPRAVNACGINCSALLQDDITAAIQCAKRVVRD-----PQGIRAWVAWRA 132

  Fly   711 HCRNQNLAK-LSDC 723
            ||:|::|:: :.:|
Mouse   133 HCQNRDLSQYIRNC 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8492NP_648151.2 LYZ1 18..142 CDD:238066
LYZ1 185..312 CDD:238066
LYZ1 439..566 CDD:238066
LYZ1 596..723 CDD:238066 46/136 (34%)
PARM 937..>1068 CDD:293666
Lyz2NP_059068.1 LYZ1 19..147 CDD:197612 47/138 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.