DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GBP7 and atl

DIOPT Version :9

Sequence 1:NP_997281.2 Gene:GBP7 / 388646 HGNCID:29606 Length:638 Species:Homo sapiens
Sequence 2:NP_001287506.1 Gene:atl / 42934 FlyBaseID:FBgn0039213 Length:541 Species:Drosophila melanogaster


Alignment Length:443 Identity:99/443 - (22%)
Similarity:179/443 - (40%) Gaps:86/443 - (19%)


- Green bases have known domain annotations that are detailed below.


Human     2 ASEIHMPGPVCLTENTKGHLVVNSEAL-EIL---SAITQPVVVVAIVGLYRTGKSYLM------- 55
            |||.|.             .|:|.:|| |:|   ....:.|.||::.|.:|.|||:|:       
  Fly    11 ASEEHT-------------FVLNEDALSEVLMRDEVKDRFVCVVSVAGAFRKGKSFLLDFFLRYM 62

Human    56 ----------NKLAGKN---KGFPLGCTVKSETKGIWMW----CVPHPSKPNHTLILLDTEGLGD 103
                      :.|.|::   :||......:.:|.||.||    ...:|:.....:|||||:|..|
  Fly    63 YSKYVHHDATDWLGGESDPLEGFSWRGGSERDTTGILMWSDIFLHDYPNGDKIAIILLDTQGAFD 127

Human   104 MEKSDPKSDSWIFALAVLLSSSFVYNSMGTINHQALEQLHYVTELTELIRAKSCPRPDEVEDSSE 168
             .:|..:..:.:|||:.:|||..:||....|....|:.|...||...|..|.:..:|        
  Fly   128 -SQSTVRDCATVFALSTMLSSVQIYNLSQNIQEDDLQHLQLFTEYGRLALADTGKKP-------- 183

Human   169 FVSFFPDFIWTVRDFTLELKLDGHPITEDEYLENALKLISGKNPQIQNSNKPREWIRHFFPKQKC 233
                |....:.|||::...:.:...:..|:.|:..|::...::|::|:.   |..|...|.:..|
  Fly   184 ----FQRLQFLVRDWSFPYEAEYGALGGDKILKRRLEVSDKQHPELQSL---RRHISSCFTEVAC 241

Human   234 FVFDRPINDKKLLLHVEEVREDQLDSNFQMQSENFCSYIFTHAKTKTLREGIL---VTGNR---- 291
            |:...|        .:......:.|...|..:..|.|.:.:........:.::   ::|.|    
  Fly   242 FLMPHP--------GLNVATNPKFDGRLQDITPEFKSSLRSLVPMLLAPDNLVYKEISGQRVRAR 298

Human   292 -LGMLVETYLDAINSGATPCLENAMAVLAQCENSAAVQRAANHYSQQMAQQVRFPTDTLQELLDV 355
             |....::|::.......|..::.:...|:..:..||..|...|.|.|.:..   ..|...|...
  Fly   299 DLIQYFQSYMNIYKGNELPEPKSMLVATAEANHLTAVAAAKELYGQLMEEVC---GGTRPYLSTA 360

Human   356 HAVCEREAI---AVFMEYSFKDK------SQEFQKKLVDTMEKKKEDFVLQNE 399
            |...|...:   |:| :::.|.|      :::|:|:|.|.:|:...::...||
  Fly   361 HLQTEHLRVKDKALF-QFAAKRKMGGEEFTEKFRKQLEDDLEEVFTNYQAHNE 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GBP7NP_997281.2 GTPase domain (Globular). /evidence=ECO:0000250 1..310 76/343 (22%)
GBP 18..281 CDD:280433 68/290 (23%)
GBP_C 283..579 CDD:202427 27/134 (20%)
GBP_C 289..579 CDD:293879 27/125 (22%)
coiled coil 548..559 CDD:293879
coiled coil 568..579 CDD:293879
atlNP_001287506.1 GBP 14..289 CDD:280433 69/311 (22%)
MSC <316..>471 CDD:286487 23/101 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142064
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2037
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027269at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.