DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GBP7 and atln-1

DIOPT Version :9

Sequence 1:NP_997281.2 Gene:GBP7 / 388646 HGNCID:29606 Length:638 Species:Homo sapiens
Sequence 2:NP_001023492.1 Gene:atln-1 / 177059 WormBaseID:WBGene00021868 Length:573 Species:Caenorhabditis elegans


Alignment Length:435 Identity:99/435 - (22%)
Similarity:174/435 - (40%) Gaps:74/435 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    13 LTENTKGHLVVNSEALEIL----SAITQPVVVVAIVGLYRTGKSYLMN-------------KLAG 60
            :.|:|.....:|:|.||.:    ....:.|.|:.:.|.||.|||:|:|             |:.|
 Worm    38 VVEDTDHSFELNTELLEKILLDPKVADKKVAVIGVAGAYRKGKSFLLNFFLRYLTWRSKADKVMG 102

Human    61 KNK--------------GFPLGCTVKSETKGIWMWCVPHPSKPNH----TLILLDTEGLGDMEKS 107
            :.:              ||......:.:|.||.:|..|...|..:    .::|:||:|..| .:|
 Worm   103 EVELDNSQWMSPNSPLSGFSWRGGSERDTNGILIWSEPFIMKDKNGEEIAVLLMDTQGAFD-SQS 166

Human   108 DPKSDSWIFALAVLLSSSFVYNSMGTINHQALEQLHYVTELTELIRAKSCPRPDEVEDSSEFVSF 172
            ..|..:.||||:.::||..:||....|....|:.|...||...|....|..:|            
 Worm   167 TVKDCATIFALSTMISSVQIYNLSQNIQEDDLQHLQLFTEYGRLALEDSASKP------------ 219

Human   173 FPDFIWTVRDFTLELKLDGHPITEDEYLENALKLISGKNPQIQNSNKPREWIRHFFPKQKCFVFD 237
            |...::.|||::...:.:.........|:..|::...::.::|   :.|:.||..|...:||:..
 Worm   220 FQSLLFLVRDWSFPYEAEFGFQGGQRVLDRRLEVSEKQHAELQ---QLRQHIRSCFEDIRCFLMP 281

Human   238 RP-----IN---DKKLLLHVEEVREDQLDSNFQMQSENFCSYIF-THAKTKTLREGILVTGNRLG 293
            .|     .|   |.||:         .:::.||.|.......:. :||.......|..:|...|.
 Worm   282 HPGLKVATNPNFDGKLV---------DIENEFQQQLGVMIPRLLDSHALVHKEINGQKMTCRELL 337

Human   294 MLVETYLDAINSGATPCLENAMAVLAQCENSAAVQRAANHYSQQMAQQV--RFPTDTLQELLDVH 356
            ...:.|:........|..::.:...|:..|.|||..|...|.::|.:..  ..|..:..|||:.|
 Worm   338 EYFKAYMHIFRGQDLPEPKSMLMATAEANNLAAVASARAVYQREMEEVCGGDTPYMSTNELLEHH 402

Human   357 AVCEREAIAVF---MEYSFKDKSQEFQKKLVDTMEKKKEDFVLQN 398
            ...:..||..|   .:....|.|.:|.::|...:::..|:::..|
 Worm   403 DRVKNIAIREFRNARKMGGVDFSMQFLERLESDLQESYENYLKVN 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GBP7NP_997281.2 GTPase domain (Globular). /evidence=ECO:0000250 1..310 76/340 (22%)
GBP 18..281 CDD:280433 70/306 (23%)
GBP_C 283..579 CDD:202427 27/121 (22%)
GBP_C 289..579 CDD:293879 25/115 (22%)
coiled coil 548..559 CDD:293879
coiled coil 568..579 CDD:293879
atln-1NP_001023492.1 P-loop_NTPase 43..325 CDD:393306 70/306 (23%)
GBP_C 351..>447 CDD:308475 22/95 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027269at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.