DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mcad and Acox3

DIOPT Version :9

Sequence 1:NP_648149.1 Gene:Mcad / 38864 FlyBaseID:FBgn0035811 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_445791.2 Gene:Acox3 / 83522 RGDID:69245 Length:700 Species:Rattus norvegicus


Alignment Length:426 Identity:95/426 - (22%)
Similarity:164/426 - (38%) Gaps:84/426 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LTEDQLQLQELARKFTREEIIPVAAQYDKSGEYPWPIIKKAWELGLMNNHIPADI--GGLDLDVF 99
            |..|.|    .||.|..:  :|:    :|..|..:...|:.:|.|..|   ..|:  ..|.:.|.
  Rat    55 LENDPL----FARPFGAD--LPL----EKERELNFLRCKRVFEYGFFN---AEDMLKNPLKILVL 106

  Fly   100 TTCLSAEE--LAYGCTGIMTALEASGLGQTPVILSGNKEQKKKYLGRLLEEPLVAAYCVTEPGAG 162
            ..||...:  ||..|     .|.....|.|  |:....|...|||.::....:...:.:||...|
  Rat   107 MNCLGMYDWSLANKC-----VLHMLVFGST--IIGSGSEHHFKYLEKIYNLEIFGCFALTELSHG 164

  Fly   163 SDVSGIKTRA--EKKGDEWVIN-----GQKMWITN-GGVANWYFVLART-NPDPKCPPSKAFTGF 218
            |:...::|.|  :....|::::     ..|.|:.| |..|....|.|:. .||.:|   :....|
  Rat   165 SNTKAMRTTAHYDPATQEFILHSPDFEAAKFWVGNLGKTATHAVVFAQLYTPDGQC---RGLHSF 226

  Fly   219 IVE-RD------SPGLTPGRKELNMGQRASDTRGITFEDVRVPKENVL------IGEG---AGFK 267
            :|: ||      .||:..|.....:||...|.....|..||:|::|:|      ..||   ..||
  Rat   227 LVQIRDPKTLLPMPGVMVGDMGKKLGQNGLDNGFAMFHKVRIPRQNLLDRTGNVTSEGTYNTPFK 291

  Fly   268 -------IAMGTFDKTRPPVAAGAVGLAQRCLDEALKYALERKTFG------VPIAYHQAVQFML 319
                   .::|:....|..:.:.:|...:..:..|::::..|:.||      :|:..:...|:.|
  Rat   292 DVRQRLGASLGSLSSGRISIISISVVNLKLAVIIAIRFSATRRQFGPTDKEEIPVLEYPLQQWRL 356

  Fly   320 ------------------ADMAIGVETSRLAWRLSAWEIDQGRRNSYYASIAKCHAADMANKIAS 366
                              .|: |.::..|.:...|..:.:.||.....||..|..|:..|.:...
  Rat   357 LPYLAAAYALDHFSKTIFLDL-IELQRGRQSGDHSDRQAELGREIHALASAGKPLASWTAQRGIQ 420

  Fly   367 DAVQIFGGNGFNSEYPVEKLMRDAKIYQIYEGTSQI 402
            :..:..||:|:.:.....:|..|......|||.:.:
  Rat   421 ECREACGGHGYLAMNRFGELRNDNDPNCTYEGDNNV 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
McadNP_648149.1 CaiA 35..411 CDD:224871 95/426 (22%)
MCAD 37..414 CDD:173846 95/426 (22%)
Acox3NP_445791.2 AXO 19..672 CDD:173839 95/426 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.