DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mcad and ACOX3

DIOPT Version :9

Sequence 1:NP_648149.1 Gene:Mcad / 38864 FlyBaseID:FBgn0035811 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001362712.1 Gene:ACOX3 / 8310 HGNCID:121 Length:700 Species:Homo sapiens


Alignment Length:414 Identity:94/414 - (22%)
Similarity:159/414 - (38%) Gaps:91/414 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KKAWELGLMNNHIPADIGGLDLDV-------FTTC--------LSAEEL---------AYGCTGI 115
            ||.....|.|:.:.|...|.||.:       |..|        ||.|::         ...|.|:
Human    48 KKTIFSALENDPLFARSPGADLSLEKYRELNFLRCKRIFEYDFLSVEDMFKSPLKVPALIQCLGM 112

  Fly   116 M-TALEASGLGQTPV----ILSGNKEQKKKYLGRLLEEPLVAAYCVTEPGAGSDVSGIKTRA--E 173
            . ::|.|..|..:.|    :.|...|:...|:.::....:...:.:||...||:...|:|.|  :
Human   113 YDSSLAAKYLLHSLVFGSAVYSSGSERHLTYIQKIFRMEIFGCFALTELSHGSNTKAIRTTAHYD 177

  Fly   174 KKGDEWVIN-----GQKMWITN-GGVANWYFVLARTNPDPKCPPSKAFTG---FIVE-RD----- 223
            ...:|::|:     ..|.|:.| |..|....|.|:.     |.|.....|   |||: ||     
Human   178 PATEEFIIHSPDFEAAKFWVGNMGKTATHAVVFAKL-----CVPGDQCHGLHPFIVQIRDPKTLL 237

  Fly   224 -SPGLTPGRKELNMGQRASDTRGITFEDVRVPKENVL--IG----EGA----------GFKIAMG 271
             .||:..|.....:||...|.....|..||||::::|  :|    ||.          .|..::|
Human   238 PMPGVMVGDIGKKLGQNGLDNGFAMFHKVRVPRQSLLNRMGDVTPEGTYVSPFKDVRQRFGASLG 302

  Fly   272 TFDKTRPPVAAGAVGLAQRCLDEALKYALERKTFG------VPIAYHQAVQ-----FMLADMAIG 325
            :....|..:.:.|:...:..:..||:::..|:.||      :|:..:...|     ::.|..|:.
Human   303 SLSSGRVSIVSLAILNLKLAVAIALRFSATRRQFGPTEEEEIPVLEYPMQQWRLLPYLAAVYALD 367

  Fly   326 ----------VETSR--LAWRLSAWEIDQGRRNSYYASIAKCHAADMANKIASDAVQIFGGNGFN 378
                      ||..|  .:...||.:.:.||.....||.:|..|:....:...:..:..||:|:.
Human   368 HFSKSLFLDLVELQRGLASGDRSARQAELGREIHALASASKPLASWTTQQGIQECREACGGHGYL 432

  Fly   379 SEYPVEKLMRDAKIYQIYEGTSQI 402
            :...:..|..|......|||.:.|
Human   433 AMNRLGVLRDDNDPNCTYEGDNNI 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
McadNP_648149.1 CaiA 35..411 CDD:224871 94/414 (23%)
MCAD 37..414 CDD:173846 94/414 (23%)
ACOX3NP_001362712.1 AXO 19..672 CDD:173839 94/414 (23%)
Microbody targeting signal. /evidence=ECO:0000250|UniProtKB:Q63448 698..700
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.