DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mcad and ACOX2

DIOPT Version :9

Sequence 1:NP_648149.1 Gene:Mcad / 38864 FlyBaseID:FBgn0035811 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_003491.1 Gene:ACOX2 / 8309 HGNCID:120 Length:681 Species:Homo sapiens


Alignment Length:337 Identity:76/337 - (22%)
Similarity:130/337 - (38%) Gaps:77/337 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 GNKEQKKKYLGRLLEEPL------VAAYCVTEPGAGSDVSGIKTRA--EKKGDEWVINGQKMWIT 189
            |::||..|:      :||      :|.|..||.|.|:.:.|::|.|  :....|:||:...:..|
Human   130 GSEEQIAKW------DPLCKNIQIIATYAQTELGHGTYLQGLETEATYDAATQEFVIHSPTLTAT 188

  Fly   190 N------GGVANWYFVLARTNPDPKCPPS-KAFTGFIVERDS-------PGLTPGRKELNMGQRA 240
            .      |..|....|.|:.    .|..: :....|||...|       ||:..|.....|....
Human   189 KWWPGDLGRSATHALVQAQL----ICSGARRGMHAFIVPIRSLQDHTPLPGIIIGDIGPKMDFDQ 249

  Fly   241 SDTRGITFEDVRVPKENVL------IGEGAGFKIAMGTFDKTRPPVAAGAVGL--------AQRC 291
            :|...:....||||:||:|      :.:|...|  :||......|:....|.|        .|:.
Human   250 TDNGFLQLNHVRVPRENMLSRFAQVLPDGTYVK--LGTAQSNYLPMVVVRVELLSGEILPILQKA 312

  Fly   292 LDEALKYALERKTFGV----PIA----YHQAVQFMLADMAIGVETSRLAWRLSAWEIDQGRRNSY 348
            ...|::|::.|:...:    |.|    |....|.:...:||......||  :|..|..|   :||
Human   313 CVIAMRYSVIRRQSRLRPSDPEAKVLDYQTQQQKLFPQLAISYAFHFLA--VSLLEFFQ---HSY 372

  Fly   349 -------YASIAKCHAAD-----MANKIASDAVQI----FGGNGFNSEYPVEKLMRDAKIYQIYE 397
                   ::.:.:.||..     |.::..:...::    .||:|::....:..|:........||
Human   373 TAILNQDFSFLPELHALSTGMKAMMSEFCTQGAEMCRRACGGHGYSKLSGLPSLVTKLSASCTYE 437

  Fly   398 GTSQIQRLIISR 409
            |.:.:..|.::|
Human   438 GENTVLYLQVAR 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
McadNP_648149.1 CaiA 35..411 CDD:224871 76/337 (23%)
MCAD 37..414 CDD:173846 76/337 (23%)
ACOX2NP_003491.1 ACAD 20..655 CDD:324545 76/337 (23%)
Microbody targeting signal. /evidence=ECO:0000255 679..681
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.