DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mcad and acox1

DIOPT Version :9

Sequence 1:NP_648149.1 Gene:Mcad / 38864 FlyBaseID:FBgn0035811 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001005933.1 Gene:acox1 / 449662 ZFINID:ZDB-GENE-041010-219 Length:660 Species:Danio rerio


Alignment Length:346 Identity:80/346 - (23%)
Similarity:136/346 - (39%) Gaps:88/346 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 EQKKKYLGRLLEEPLVAAYCVTEPGAGSDVSGIKTRA--EKKGDEWVINGQ-----KMWITNGGV 193
            ||:||::.......::..|..||.|.|:.:..::|.|  :....|:|:|..     |.|  .||:
Zfish   118 EQRKKWIPLAESFHMLGTYAQTELGHGTHIRALETTATYDPSTQEFVLNSSTISSIKWW--PGGL 180

  Fly   194 ---ANWYFVLARTNPDPKCPPSKAFTGFI----VERDSPGLTPGRKELNMGQRASDTRGITFEDV 251
               :|...|||:.....||....||...|    .....||:..|......|....|...:..|:|
Zfish   181 GKTSNHAIVLAQLYTQGKCHGLHAFITPIRCMKTHMPLPGVVVGDIGPKFGFDEVDNGYLKLENV 245

  Fly   252 RVPKENVLIGEGAGFKIAM----GTFDKTRPP-----------VAAGAVGLAQRCLDE----ALK 297
            |:|:||:|:      |.|.    ||:  .:||           :.:..||.:.|.|.:    |::
Zfish   246 RIPRENMLM------KYAQVEPDGTY--VKPPSDKLTYGTMVFIRSMIVGESARALSKSCTIAIR 302

  Fly   298 YALERKTF----GVP---IAYHQAVQFMLADMA--------IGVETSRLAWRLSAWEIDQGRRNS 347
            |:..|...    |.|   |..:|..|:.|..:.        :|...::...|:|. :|..|.   
Zfish   303 YSAVRHQSELRPGEPEPQILDYQTQQYKLFPLLATAYAFHFVGQYMNKTYHRISG-DISLGD--- 363

  Fly   348 YYASIAKCHAADMANK-----IASDAVQI----FGGNGFN--SEYPVEKLMRDAKIYQ------I 395
             ::.:.:.||.....|     .|:..:::    .||:|::  |..|        .||.      .
Zfish   364 -FSELPELHALSAGLKAFTTWAANTGIEVCRMSCGGHGYSRCSSLP--------DIYVTFTPTCT 419

  Fly   396 YEGTSQIQRLIISRNMYEAAK 416
            |||.:.:..|..:|.:.::.|
Zfish   420 YEGENTVMMLQTARYLVKSYK 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
McadNP_648149.1 CaiA 35..411 CDD:224871 79/339 (23%)
MCAD 37..414 CDD:173846 79/342 (23%)
acox1NP_001005933.1 AXO 3..637 CDD:173839 80/346 (23%)
PLN02443 5..656 CDD:178062 80/346 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.