DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mcad and acads

DIOPT Version :9

Sequence 1:NP_648149.1 Gene:Mcad / 38864 FlyBaseID:FBgn0035811 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001003743.1 Gene:acads / 445288 ZFINID:ZDB-GENE-040808-64 Length:405 Species:Danio rerio


Alignment Length:414 Identity:154/414 - (37%)
Similarity:238/414 - (57%) Gaps:18/414 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFLNKLAAPALRQLVSQSRAYAAVSHVSPNGTSFALTEDQLQLQELARKFTREEIIPVAAQYDK 65
            ||.|.|    |.|.:::..|....::.::      .|.|....:::..|.:.::|:.|:|...||
Zfish     1 MAALFK----AQRVVMALGRGVRCLTQLA------ELPELHQMMRQTCRDYAQKELAPIAGLLDK 55

  Fly    66 SGEYPWPIIKKAWELGLMNNHIPADIGGLDLDVFTTCLSAEELAYGC--TGIMTALEASGLGQTP 128
            ...:|...:::...:|:|...:|..:||..:|....||:.|||:.||  ||::.::..| |...|
Zfish    56 EHRFPAKQVQELGAMGVMAVEVPESLGGAGMDYLAYCLAVEELSRGCASTGVIVSVNNS-LYIGP 119

  Fly   129 VILSGNKEQKKKYLGRLLEEPLVAAYCVTEPGAGSDVSGIKTRAEKKGDEWVINGQKMWITNGGV 193
            ::..|::||||:::........|..:.::|||.|||.....|.|:::|:|||:||.|.||||...
Zfish   120 ILKFGSEEQKKQWITPFTTGEKVGCFALSEPGNGSDAGAASTLAQQEGNEWVLNGTKAWITNSWD 184

  Fly   194 ANWYFVLARTNPDPKCPPSKAFTGFIVERDSPGLTPGRKELNMGQRASDTRGITFEDVRVPKENV 258
            |:...|.|.|:...|   .|..:.|:|....|||:.|:||..:|.|||.|..|..||.|:|..|:
Zfish   185 ASATVVFATTDKSLK---HKGISAFLVPMPHPGLSLGKKEDKLGIRASSTANIILEDCRIPLGNM 246

  Fly   259 LIGEGAGFKIAMGTFDKTRPPVAAGAVGLAQRCLDEALKYALERKTFGVPIAYHQAVQFMLADMA 323
            |...|.||||||.|.|..|..:||.|:|:||..||.|..||.:|..||.||...||:||.|||||
Zfish   247 LGERGMGFKIAMQTLDSGRLGIAAQALGIAQAALDCAADYAHKRTAFGAPIGKLQAIQFKLADMA 311

  Fly   324 IGVETSR-LAWRLSAWEIDQGRRNSYYASIAKCHAADMANKIASDAVQIFGGNGFNSEYPVEKLM 387
            :.:|::| |.|: :|...|..:..:..|::||..|::.|...:..|:|:.||.|:.::.|.|:..
Zfish   312 VAIESARLLTWK-AALLRDAKKPFTKEAAMAKLAASEAATFASHQAIQVLGGMGYVTDMPAERHY 375

  Fly   388 RDAKIYQIYEGTSQIQRLIISRNM 411
            |||:|.:||||||:||||:|:.|:
Zfish   376 RDARITEIYEGTSEIQRLVIANNI 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
McadNP_648149.1 CaiA 35..411 CDD:224871 146/378 (39%)
MCAD 37..414 CDD:173846 147/378 (39%)
acadsNP_001003743.1 CaiA 26..405 CDD:224871 147/379 (39%)
SCAD_SBCAD 29..401 CDD:173847 146/376 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D589058at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101120
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.