DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mcad and CG6638

DIOPT Version :9

Sequence 1:NP_648149.1 Gene:Mcad / 38864 FlyBaseID:FBgn0035811 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_648239.1 Gene:CG6638 / 38979 FlyBaseID:FBgn0035911 Length:420 Species:Drosophila melanogaster


Alignment Length:395 Identity:142/395 - (35%)
Similarity:204/395 - (51%) Gaps:4/395 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VSHVSPNGTSFALTEDQLQLQELARKFTREEIIPVAAQYDKSGEYP--WPIIKKAWELGLMNNHI 87
            ::|...|...|.|.||:.:|:|:|..|.::|:.|:|.:.||...:.  .|..||...||.:....
  Fly    27 LAHYPVNDAMFGLDEDRQKLREVAFNFFQKELAPLAKEIDKLDNFKDMRPFWKKLGALGFLGITA 91

  Fly    88 PADIGGLDLDVFTTCLSAEELAYGCTGIMTALEA-SGLGQTPVILSGNKEQKKKYLGRLLEEPLV 151
            ..|.||........|:..||.:....|:..:..| |.|....:..:|..|||:|||.:|.....|
  Fly    92 EPDFGGTGGSYLDHCIIMEEFSRAAGGVALSYGAHSNLCINQLTKNGTPEQKEKYLPKLCSGEHV 156

  Fly   152 AAYCVTEPGAGSDVSGIKTRAEKKGDEWVINGQKMWITNGGVANWYFVLARTNPDPKCPPSKAFT 216
            ....::||||||||..:|.|||:|||.:|:||.|.|||||..|:...|.|:|. ....|.....|
  Fly   157 GGLAMSEPGAGSDVVSMKLRAERKGDYYVLNGSKFWITNGSDADTLIVYAKTG-GSGVPDKHGIT 220

  Fly   217 GFIVERDSPGLTPGRKELNMGQRASDTRGITFEDVRVPKENVLIGEGAGFKIAMGTFDKTRPPVA 281
            .||||....|.:..:|...:|.|.|.|..:.|:|::||.:|:|..|..|..:.|...|..|..:|
  Fly   221 AFIVETAWEGFSVAQKLDKLGMRGSSTCELVFQDLKVPAKNILGQENRGVYVLMSGLDFERLVLA 285

  Fly   282 AGAVGLAQRCLDEALKYALERKTFGVPIAYHQAVQFMLADMAIGVETSRLAWRLSAWEIDQGRRN 346
            ||.|||.|...|.|..||.:||.....|...|.:|..:|||...:...|......|...|.|.|:
  Fly   286 AGPVGLMQAACDVAFDYAHQRKQMNKLIGEFQLLQGKMADMYTTLSACRSYLYTVARSCDAGNRS 350

  Fly   347 SYYASIAKCHAADMANKIASDAVQIFGGNGFNSEYPVEKLMRDAKIYQIYEGTSQIQRLIISRNM 411
            ....:....:.|:.|.|:|.||:||.||||:.:|.|..:::||||:|:|..|||:|:|.:|.|.:
  Fly   351 PKDCAGVILYTAEKATKVALDAIQILGGNGYINENPTGRILRDAKLYEIGAGTSEIRRWLIGRQL 415

  Fly   412 YEAAK 416
            .:..|
  Fly   416 NQEYK 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
McadNP_648149.1 CaiA 35..411 CDD:224871 139/378 (37%)
MCAD 37..414 CDD:173846 138/379 (36%)
CG6638NP_648239.1 PLN02519 14..418 CDD:215284 141/391 (36%)
IVD 38..417 CDD:173845 138/379 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460748
Domainoid 1 1.000 70 1.000 Domainoid score I509
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I179
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D53071at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9754
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.